PDB entry 1ol0

View 1ol0 on RCSB PDB site
Description:
Deposited on 2003-08-02, released 2004-01-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-22, with a file datestamp of 2004-01-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.15576
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ol0a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1ol0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ol0A (A:)
    qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
    adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
    s
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ol0B (B:)
    qvqlvesggglvqpggslrlscaasgftfssyamswfrqapgkereivsavsgsggstyy
    adsvrgrftisrdnskntlylqmnslraedtavyycarepriprppsfdywgqgtlvtvs
    s