PDB entry 1okz

View 1okz on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with ucn-01
Deposited on 2003-08-01, released 2004-07-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-29, with a file datestamp of 2004-07-29.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1okza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okzA (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okzA (A:)
    qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
    vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
    leylhgkgiihrdlkpenillnedmhiqitdfgtakvlnsfvgtaqyvspellteksack
    ssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvlda
    tkrlgceemegygplkahpffesvtwenlhqqtppklt