PDB entry 1oky

View 1oky on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with staurosporine
Class: transferase
Keywords: protein kinase, pkb, pdk1, staurosporine, transferase
Deposited on 2003-08-01, released 2004-07-29
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okya_
  • Heterogens: SO4, STU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okyA (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okyA (A:)
    pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
    dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
    aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspansfvgtaqyvspelltek
    sackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekll
    vldatkrlgceemegygplkahpffesvtwenlhqqtppklta