PDB entry 1oky

View 1oky on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with staurosporine
Deposited on 2003-08-01, released 2004-07-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-29, with a file datestamp of 2004-07-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1okya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okyA (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okyA (A:)
    pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
    dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
    aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspansfvgtaqyvspelltek
    sackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekll
    vldatkrlgceemegygplkahpffesvtwenlhqqtppklta