PDB entry 1okx

View 1okx on RCSB PDB site
Description: binding structure of elastase inhibitor scyptolin a
Class: hydrolase/hydrolase inhibitor
Keywords: protease, elastase, inhibitor, hydrolase, hydrolase-hydrolase inhibitor complex
Deposited on 2003-07-31, released 2003-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1okxa_
  • Chain 'B':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1okxb_
  • Chain 'C':
    Compound: scyptolin a
    Species: SCYTONEMA HOFMANNI [TaxId:34078]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKX (0-7)
  • Chain 'D':
    Compound: scyptolin a
    Species: SCYTONEMA HOFMANNI [TaxId:34078]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKX (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okxA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okxB (B:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.