PDB entry 1okt

View 1okt on RCSB PDB site
Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
Class: transferase
Keywords: gst, plasmodium falciparum, transferase
Deposited on 2003-07-29, released 2003-11-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okta1, d1okta2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oktb1, d1oktb2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oktA (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oktB (B:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy