PDB entry 1okt

View 1okt on RCSB PDB site
Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum
Deposited on 2003-07-29, released 2003-11-20
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-04, with a file datestamp of 2003-12-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.222
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oktA (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oktB (B:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy