PDB entry 1oks

View 1oks on RCSB PDB site
Description: crystal structure of the measles virus phosphoprotein xd domain
Deposited on 2003-07-29, released 2003-09-01
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-06, with a file datestamp of 2003-11-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.20009
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oksa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oksA (A:)
    masrsvirsiikssrleedrkrylmtllddikgandlakfhqmlvkiimkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oksA (A:)
    asrsvirsiikssrleedrkrylmtllddikgandlakfhqmlvkiimkhhhhh