PDB entry 1okr

View 1okr on RCSB PDB site
Description: three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.
Deposited on 2003-07-28, released 2003-10-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-16, with a file datestamp of 2003-10-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1okra_
  • Chain 'B':
    Domains in SCOP 1.69: d1okrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okrA (A:)
    mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
    kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
    nkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okrA (A:)
    ktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkd
    nkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okrB (B:)
    mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
    kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
    nkk