PDB entry 1okq

View 1okq on RCSB PDB site
Description: laminin alpha 2 chain lg4-5 domain pair, ca1 site mutant
Class: metal binding protein
Keywords: metal binding protein, laminin
Deposited on 2003-07-28, released 2003-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laminin alpha 2 chain
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKQ (369-End)
      • conflict (48)
      • conflict (77)
      • engineered mutation (83)
      • conflict (85)
      • conflict (95)
      • conflict (104)
      • conflict (106)
      • engineered mutation (151)
      • conflict (153)
      • conflict (221)
      • conflict (228)
      • conflict (251)
      • conflict (297)
      • conflict (369)
    • Uniprot Q60675 (Start-368)
    Domains in SCOPe 2.07: d1okqa1, d1okqa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okqA (A:)
    aplasvptpafpfpvptmvhgpcvaesepalltgskqfglsrnshiaiafddtkvknrlt
    ielevrteaesgllfymarinhaafatvqlrngfpyfsydlgsgdtstmiptkindgqwh
    kikivrvkqegilyvddassqtispkkadilavvgilyvgglpinyttrrigpvtysldg
    cvrnlhmeqapvdldqptssfhvgtcfanaesgtyfdgtgfakavggfkvgldllvefef
    rttrptgvllgvssqkmdgmgiemideklmfhvdngagrftaiydaeipghmcngqwhkv
    takkiknrlelvvdgnqvdaqspnsastsadtndpvfvggfpgglnqfglttnirfrgci
    rslkltkgtgkplevnfakalelrgvqpvscptt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okqA (A:)
    hgpcvaesepalltgskqfglsrnshiaiafddtkvknrltielevrteaesgllfymar
    inhaafatvqlrngfpyfsydlgsgdtstmiptkindgqwhkikivrvkqegilyvddas
    sqtispkkadilavvgilyvgglpinyttrrigpvtysldgcvrnlhmeqapvdldqpts
    sfhvgtcfanaesgtyfdgtgfakavggfkvgldllvefefrttrptgvllgvssqkmdg
    mgiemideklmfhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvd
    aqspnsastsadtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfak
    alelrgvqpvscpt