PDB entry 1okk

View 1okk on RCSB PDB site
Description: homo-heterodimeric complex of the srp gtpases
Deposited on 2003-07-26, released 2004-01-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-08, with a file datestamp of 2004-03-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.15616
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okkA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okkA (A:)
    qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
    vlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklalyyk
    gkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarleardl
    ilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvtglv
    ltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1okkD (D:)
    gffdrlkaglaktrerllkaipwggnleevleelemallaadvglsateeilqevrasgr
    kdlkeavkeklvgmlepderratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttiak
    lgryyqnlgkkvmfcagdtfraaggtqlsewgkrlsipviqgpegtdpaalaydavqamk
    argydllfvdtagrlhtkhnlmeelkkvkraiakadpeepkevwlvldavtgqngleqak
    kfheavgltgvivtkldgtakggvlipivrtlkvpikfvgvgegpddlqpfdpeafveal
    led
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okkD (D:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmleppv
    epkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrlsi
    pviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiakadp
    eepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvpik
    fvgvgegpddlqpfdpeafvealle