PDB entry 1okj

View 1okj on RCSB PDB site
Description: crystal structure of the essential e. coli yeaz protein by mad method using the gadolinium complex "dotma"
Class: hydrolase
Keywords: POTENTIAL ZINC PROTEASE, HYPOTHETICAL PROTEASE YEAZ, METALLOPROTEASE, HYDROLASE, Bacterial targets at IGS-CNRS, France, BIGS, Structural Genomics
Deposited on 2003-07-26, released 2004-09-16
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.216
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protease yeaz
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okja1, d1okja2
  • Chain 'B':
    Compound: hypothetical protease yeaz
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okjb1, d1okjb2
  • Chain 'C':
    Compound: hypothetical protease yeaz
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okjc1, d1okjc2
  • Chain 'D':
    Compound: hypothetical protease yeaz
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1okjd1, d1okjd2
  • Heterogens: GD3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okjA (A:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjA (A:)
    glrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinal
    aygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarm
    gevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesgl
    vlrdgevllpaaedmlpiacqmfaegktvavehaepvylr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1okjB (B:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjB (B:)
    kkaglrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdi
    nalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaid
    armgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgke
    sglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1okjC (C:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjC (C:)
    glrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinal
    aygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarm
    gevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesgl
    vlrdgevllpaaedmlpiacqmfaegktvavehaepvyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1okjD (D:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjD (D:)
    aglrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdina
    laygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidar
    mgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesg
    lvlrdgevllpaaedmlpiacqmfaegktvavehaepvylr