PDB entry 1oki

View 1oki on RCSB PDB site
Description: crystal structure of truncated human beta-b1-crystallin
Deposited on 2003-07-25, released 2004-01-22
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-22, with a file datestamp of 2004-01-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17224
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okiA (A:)
    tvpitsakaaelppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwv
    afeqsnfrgemfilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgn
    tieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgaf
    qpqmqslrrlrdkqwhlegsfpvlateppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okiA (A:)
    ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
    ilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgntieiqgddapsl
    wvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgafqpqmqslrrlrd
    kqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1okiB (B:)
    tvpitsakaaelppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwv
    afeqsnfrgemfilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgn
    tieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgaf
    qpqmqslrrlrdkqwhlegsfpvlateppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okiB (B:)
    ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
    ilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgntieiqgddapsl
    wvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgafqpqmqslrrlrd
    kqwh