PDB entry 1oki

View 1oki on RCSB PDB site
Description: Crystal structure of truncated human beta-B1-crystallin
Class: eye lens protein
Keywords: crystallin, cataract, eye lens protein
Deposited on 2003-07-25, released 2004-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta crystallin b1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1okia1, d1okia2
  • Chain 'B':
    Compound: beta crystallin b1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1okib1, d1okib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okiA (A:)
    tvpitsakaaelppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwv
    afeqsnfrgemfilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgn
    tieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgaf
    qpqmqslrrlrdkqwhlegsfpvlateppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okiA (A:)
    ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
    ilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgntieiqgddapsl
    wvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgafqpqmqslrrlrd
    kqw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1okiB (B:)
    tvpitsakaaelppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwv
    afeqsnfrgemfilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgn
    tieiqgddapslwvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgaf
    qpqmqslrrlrdkqwhlegsfpvlateppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okiB (B:)
    ppgnyrlvvfelenfqgrraefsgecsnladrgfdrvrsiivsagpwvafeqsnfrgemf
    ilekgeyprwntwsssyrsdrlmsfrpikmdaqehkislfeganfkgntieiqgddapsl
    wvygfsdrvgsvkvssgtwvgyqypgyrgyqyllepgdfrhwnewgafqpqmqslrrlrd
    kqwh