PDB entry 1oke
View 1oke on RCSB PDB site
Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
Class: Viral protein
Keywords: dengue virus, membrane fusion, flavivirus, fusion peptide, low-ph conformational change, trimer, class 2 fusion protein, virus/viral protein
Deposited on
2003-07-22, released
2003-07-24
The last revision prior to the SCOP 1.73 freeze date was dated
2003-07-24, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.0795
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: major envelope protein E
Species: DENGUE VIRUS TYPE 2
Database cross-references and differences (RAF-indexed):
- Uniprot P12823 (0-393)
- conflict (70)
- conflict (389)
Domains in SCOP 1.73: d1okea1, d1okea2 - Chain 'B':
Compound: major envelope protein E
Species: DENGUE VIRUS TYPE 2
Database cross-references and differences (RAF-indexed):
- Uniprot P12823 (0-393)
- conflict (70)
- conflict (389)
Domains in SCOP 1.73: d1okeb1, d1okeb2 - Heterogens: NAG, BOG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1okeA (A:)
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
kdspvnieaeppfgdsyiiigvepgqlklnwfkk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1okeB (B:)
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
kdspvnieaeppfgdsyiiigvepgqlklnwfkk