PDB entry 1oke

View 1oke on RCSB PDB site
Description: Crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-D-glucoside
Class: viral protein
Keywords: viral protein, membrane fusion, flavivirus, fusion peptide, low-ph conformational change, class 2 fusion protein
Deposited on 2003-07-22, released 2003-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.5
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: DENGUE VIRUS TYPE 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1okea1, d1okea2
  • Chain 'B':
    Compound: major envelope protein E
    Species: DENGUE VIRUS TYPE 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1okeb1, d1okeb2
  • Heterogens: NAG, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okeA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okeB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk