PDB entry 1okb

View 1okb on RCSB PDB site
Description: crystal structure of uracil-DNA glycosylase from atlantic cod (gadus morhua)
Class: hydrolase
Keywords: hydrolase, uracil-DNA glycosylase, crystal structure, cold-adaptation, base excision repair, structure-function relationship
Deposited on 2003-07-21, released 2004-04-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1861
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (0-222)
      • engineered mutation (0-2)
    Domains in SCOPe 2.04: d1okba_
  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Gadus morhua [TaxId:8049]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I983 (0-222)
      • engineered mutation (0-2)
    Domains in SCOPe 2.04: d1okbb_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okbA (A:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1okbB (B:)
    meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
    lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
    llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
    hvlqavhpsplsahrgflgckhfskangllklsgtepinwral