PDB entry 1ok8

View 1ok8 on RCSB PDB site
Description: Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
Class: viral protein
Keywords: viral protein, membrane fusion, flavivirus, fusion peptide, low-ph conformational change, class 2 fusion protein,
Deposited on 2003-07-19, released 2004-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: DENGUE VIRUS TYPE 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12823 (0-393)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1ok8a1, d1ok8a2
  • Heterogens: NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ok8A (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok8A (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphgkevkitpqssiteaeltgygtvtmecsprtgldfn
    emvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakkqdvvvlg
    sqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgkfkvvkeiae
    tqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspvnieaeppfg
    dsyiiigvepgqlklnwfkk