SCOPe 2.05: Structural Classification of Proteins

PDB entry 1ok4

View 1ok4 on RCSB PDB site
Description: archaeal fructose 1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
Class: lyase
Keywords: aldolase, fructose 1, 6-bisphosphate, tim barrel, glycolytic, archaeal, lyase
Deposited on 2003-07-17, released 2003-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4a_
Chain 'B':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4b_
Chain 'C':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4c_
Chain 'D':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4d_
Chain 'E':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4e_
Chain 'F':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4f_
Chain 'G':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4g_
Chain 'H':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4h_
Chain 'I':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4i_
Chain 'J':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.05: d1ok4j_
Heterogens: 13P, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1ok4A (A:)
manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
lkfaralaelvyggkklaeplnv