PDB entry 1ok4

View 1ok4 on RCSB PDB site
Description: archaeal fructose 1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
Class: lyase
Keywords: aldolase, fructose 1, 6-bisphosphate, tim barrel, glycolytic, archaeal, lyase
Deposited on 2003-07-17, released 2003-09-04
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1636
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4a_
  • Chain 'B':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4b_
  • Chain 'C':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4c_
  • Chain 'D':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4d_
  • Chain 'E':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4e_
  • Chain 'F':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4f_
  • Chain 'G':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4g_
  • Chain 'H':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4h_
  • Chain 'I':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4i_
  • Chain 'J':
    Compound: fructose-bisphosphate aldolase class I
    Species: Thermoproteus tenax
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ok4j_
  • Heterogens: 13P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ok4A (A:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4A (A:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ok4B (B:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4B (B:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ok4C (C:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4C (C:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ok4D (D:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4D (D:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ok4E (E:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4E (E:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyggk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ok4F (F:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4F (F:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ok4G (G:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4G (G:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ok4H (H:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4H (H:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ok4I (I:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4I (I:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ok4J (J:)
    manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
    qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
    wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
    tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
    lkfaralaelvyggkklaeplnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ok4J (J:)
    nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
    giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
    mfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikytg
    dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
    faralaelvyg