PDB entry 1ojz

View 1ojz on RCSB PDB site
Description: the crystal structure of c3stau2 from s. aureus in with nad
Class: transferase
Keywords: ADP-ribosyltransferase, transferase
Deposited on 2003-07-16, released 2003-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyltransferase
    Species: STAPHYLOCOCCUS AUREUS, synthetic [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ojza_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojzA (A:)
    aetknftdlveatkwgnsliksakysskdkmaiynytknsspintplrsangdvnklsen
    iqeqvrqldstisksvtpdsvyvyrllnldylssitgftredlhmlqqtnngqynealvs
    klnnlmnsriyrengysstqlvsgaalagrpielklelpkgtkaayidskeltaypgqqe
    vllprgteyavgsvklsdnkrkiiitavvfkk