PDB entry 1oju

View 1oju on RCSB PDB site
Description: 2.8 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with etheno-nad.
Deposited on 2003-07-15, released 2004-07-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-15, with a file datestamp of 2004-07-15.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.1987
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojuA (A:)
    mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
    gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
    mdvmtyimwkesgkprnevfgmgnqldsqrlkerlynagarnirrawiigehgdsmfvak
    sladfdgevdweavendvrfvaaevikrkgatifgpavaiyrmvkavvedtgeiiptsmi
    lqgeygienvavgvpaklgkngaevadiklsdeeieklrnsakilrerleelgy