PDB entry 1ojt

View 1ojt on RCSB PDB site
Description: structure of dihydrolipoamide dehydrogenase
Class: oxidoreductase
Keywords: redox-active center, glycolysis, oxidoreductase, nad, flavoprotein, fad, p64k
Deposited on 1996-09-06, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.173
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: surface protein
    Species: Neisseria meningitidis [TaxId:487]
    Gene: M-6 OBTAINED FROM A GENOMIC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51225 (0-481)
      • conflict (381)
    Domains in SCOPe 2.07: d1ojta1, d1ojta2, d1ojta3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojtA (A:)
    gsadaeydvvvlgggpggysaafaaadeglkvaiveryktlggvclnvgcipskallhna
    avidevrhlaangikypepeldidmlraykdgvvsrltgglagmaksrkvdviqgdgqfl
    dphhlevsltagdayeqaaptgekkivafknciiaagsrvtklpfipedpriidssgala
    lkevpgklliigggiiglemgtvystlgsrldvvemmdglmqgadrdlvkvwqkqneyrf
    dnimvntktvavepkedgvyvtfeganapkepqrydavlvaagrapngklisaekagvav
    tdrgfievdkqmrtnvphiyaigdivgqpmlahkavheghvaaencaghkayfdarvipg
    vaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifdaetgrii
    gggivgpnggdmigevclaiemgcdaadigktihphptlgesigmaaevalgtctdlppq
    kk