PDB entry 1ojt

View 1ojt on RCSB PDB site
Description: structure of dihydrolipoamide dehydrogenase
Deposited on 1996-09-06, released 1997-10-15
The last revision prior to the SCOP 1.61 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.173
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojt_ (-)
    gsadaeydvvvlgggpggysaafaaadeglkvaiveryktlggvclnvgcipskallhna
    avidevrhlaangikypepeldidmlraykdgvvsrltgglagmaksrkvdviqgdgqfl
    dphhlevsltagdayeqaaptgekkivafknciiaagsrvtklpfipedpriidssgala
    lkevpgklliigggiiglemgtvystlgsrldvvemmdglmqgadrdlvkvwqkqneyrf
    dnimvntktvavepkedgvyvtfeganapkepqrydavlvaagrapngklisaekagvav
    tdrgfievdkqmrtnvphiyaigdivgqpmlahkavheghvaaencaghkayfdarvipg
    vaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifdaetgrii
    gggivgpnggdmigevclaiemgcdaadigktihphptlgesigmaaevalgtctdlppq
    kk