PDB entry 1ojr

View 1ojr on RCSB PDB site
Description: L-rhamnulose-1-phosphate aldolase from Escherichia coli (mutant E192A)
Class: lyase
Keywords: lyase, aldolase (lyase), class II, zinc enzyme, c4-tetramer, bacterial l-rhamnose metabolism, cleavage of l-rhamnulose-1- phosphate to dihydroxyacetonephosphate and l-lactaldehyde
Deposited on 2003-07-15, released 2003-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhamnulose-1-phosphate aldolase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32169 (0-273)
    • engineered mutation (191)
  Domains in SCOPe 2.08: d1ojra_
• Heterogens: ZN, PO4, 2HA, DIO, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ojrA (A:)
  mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
  pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
  hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
  gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
  vysmggmkqtisreelialgkrfgvtplasalal