PDB entry 1ojo

View 1ojo on RCSB PDB site
Description: specificity and mechanism of streptococcus pneumoniae hyaluronate lyase: complex of the tyr408phe mutant with 4-sulphated chondroitin disaccharide
Class: lyase
Keywords: lyase, protein-carbohydrate complex
Deposited on 2003-07-11, released 2003-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronate lyase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54873
      • conflict (5)
      • see remark 999 (28)
      • conflict (55)
      • engineered mutation (240)
      • conflict (328)
      • conflict (373)
      • conflict (536)
      • conflict (568)
    • PDB 1OJO
    Domains in SCOPe 2.07: d1ojoa1, d1ojoa2, d1ojoa3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ojoA (A:)
    asvkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwe
    kfsnyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksi
    vgnwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalg
    gnlvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytga
    fgnvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisra
    nseghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmq
    sllsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgw
    ytsdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskld
    danatatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpy
    kvyvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdin
    egqsdkevenefltisqahkqnrdsygymlipnvdratfnqmikelessliennetlqsv
    ydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevf
    kkleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ojoA (A:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
    snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
    nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
    lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgafg
    nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
    eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
    lsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyt
    sdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskldda
    natatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykv
    yvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdineg
    qsdkevenefltisqahkqnrdsygymlipnvdratfnqmikelessliennetlqsvyd
    akqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk
    le