PDB entry 1ojg

View 1ojg on RCSB PDB site
Description: sensory domain of the membraneous two-component fumarate sensor dcus of e. coli
Class: transferase
Keywords: transferase, fumarate, dcus, histidine kinase
Deposited on 2003-07-10, released 2003-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein dcuS
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ojga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojgA (A:)
    sdmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmq
    slryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvva
    iglelsrvtqqindsr