PDB entry 1ojg

View 1ojg on RCSB PDB site
Description: sensory domain of the membraneous two-component fumarate sensor dcus of e. coli
Deposited on 2003-07-10, released 2003-08-15
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-02, with a file datestamp of 2003-10-02.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ojga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ojgA (A:)
    sdmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmq
    slryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvva
    iglelsrvtqqindsr