PDB entry 1ojg

View 1ojg on RCSB PDB site
Description: Sensory domain of the membraneous two-component fumarate sensor DcuS of E. coli
Class: transferase
Keywords: transferase, fumarate, dcus, histidine kinase
Deposited on 2003-07-10, released 2003-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Sensor protein dcuS
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39272 (0-135)
  Domains in SCOPe 2.08: d1ojga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ojgA (A:)
  sdmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmq
  slryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvva
  iglelsrvtqqindsr