PDB entry 1oj8

View 1oj8 on RCSB PDB site
Description: novel and retro binding modes in cytotoxic ribonucleases from rana catesbeiana of two crystal structures complexed with d(apcpgpa) and (2',5'cpg)
Class: hydrolase
Keywords: cytotoxic ribonucleases, anti-tumor activity, sialic binding and nucleotide binding, hydrolase
Deposited on 2003-07-07, released 2004-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.4
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rc-rnase6 ribonuclease
    Species: RANA CATESBEIANA [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1oj8a_
  • Chain 'B':
    Compound: 5'-d(*ap*cp*gp*ap)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oj8A (A:)
    edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
    dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp
    

  • Chain 'B':
    No sequence available.