PDB entry 1oj8

View 1oj8 on RCSB PDB site
Description: Novel and retro Binding Modes in Cytotoxic Ribonucleases from Rana catesbeiana of Two Crystal Structures Complexed with d(ApCpGpA) and (2',5'CpG)
Class: hydrolase
Keywords: cytotoxic ribonucleases, anti-tumor activity, sialic binding and nucleotide binding, hydrolase
Deposited on 2003-07-07, released 2004-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rc-rnase6 ribonuclease
  Species: RANA CATESBEIANA [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DFY5 (0-104)
  Domains in SCOPe 2.08: d1oj8a_
• Chain 'B':
  Compound: 5'-d(*ap*cp*gp*ap)-3'
  
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oj8A (A:)
  edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
  dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp
  

  
  
• Chain 'B':
  No sequence available.