PDB entry 1oj5

View 1oj5 on RCSB PDB site
Description: crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
Class: transcriptional coactivator
Keywords: transcriptional coactivator, complex, lxxll motif, transcriptional regulation, stat6, pas domain, il-4 stat
Deposited on 2003-07-02, released 2004-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid receptor coactivator 1a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OJ5
      • engineered mutation (89)
    • Uniprot O61202 (Start-113)
    Domains in SCOPe 2.08: d1oj5a_
  • Chain 'B':
    Compound: signal transducer and activator of transcription 6
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oj5A (A:)
ghmtgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarql
fqevmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglsp
qddtnsgmsipr

    Sequence, based on observed residues (ATOM records): (download) 
    >1oj5A (A:)
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypmqpfimgihiidre

  • Chain 'B':
    No sequence available.