PDB entry 1oj4

View 1oj4 on RCSB PDB site
Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
Deposited on 2003-06-30, released 2003-07-31
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-13, with a file datestamp of 2003-08-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.1674
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oj4A (A:)
    mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv
    ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh
    lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpvdppekwylvahpgvsip
    tpvifkdpelprntpkrsietllkcefsndceviarkrfrevdavlswlleyapsrltgt
    gacvfaefdtesearqvleqapewlngfvakgvnlsplhraml
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oj4B (B:)
    mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv
    ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh
    lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpvdppekwylvahpgvsip
    tpvifkdpelprntpkrsietllkcefsndceviarkrfrevdavlswlleyapsrltgt
    gacvfaefdtesearqvleqapewlngfvakgvnlsplhraml