PDB entry 1oj1

View 1oj1 on RCSB PDB site
Description: Nonproductive and Novel Binding Modes in Cytotoxic Ribonucleases from Rana catesbeiana of Two Crystal Structures Complexed with (2,5 CpG) and d(ApCpGpA)
Class: hydrolase
Keywords: cytotoxic ribonucleases, anti-tumor activity, sialic binding and nucleotide binding, hydrolase
Deposited on 2003-06-28, released 2004-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rc-rnase6 ribonuclease
  Species: RANA CATESBEIANA [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DFY5 (0-104)
    • conflict (52)
  Domains in SCOPe 2.07: d1oj1a_
• Heterogens: CG2, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oj1A (A:)
  edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
  dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp