PDB entry 1oj1

View 1oj1 on RCSB PDB site
Description: nonproductive and novel binding modes in cytotoxic ribonucleases from rana catesbeiana of two crystal structures complexed with (2,5 cpg) and d(apcpgpa)
Class: hydrolase
Keywords: cytotoxic ribonucleases, anti-tumor activity, sialic binding and nucleotide binding, hydrolase
Deposited on 2003-06-28, released 2004-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rc-rnase6 ribonuclease
    Species: RANA CATESBEIANA [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DFY5 (0-104)
      • conflict (52)
    Domains in SCOPe 2.04: d1oj1a_
  • Heterogens: CG2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oj1A (A:)
    edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
    dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp