PDB entry 1oiz

View 1oiz on RCSB PDB site
Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
Deposited on 2003-06-27, released 2004-01-14
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-14, with a file datestamp of 2004-01-14.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.19665
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oizA (A:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oizA (A:)
    sagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawr
    llknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvft
    aydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfp
    lkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleygge
    efsmedicqewtnfimksedylssis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oizB (B:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oizB (B:)
    gpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawrll
    knyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftay
    dvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplk
    vrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeef
    smedicqewtnfimksedylssise