PDB entry 1oiz

View 1oiz on RCSB PDB site
Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
Class: transport
Keywords: transport, ataxia, aved, transfer protein, tocopherol, vitamin e
Deposited on 2003-06-27, released 2004-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-tocopherol transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oiza1, d1oiza2
  • Chain 'B':
    Compound: alpha-tocopherol transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oizb1, d1oizb2
  • Heterogens: TRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oizA (A:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oizA (A:)
    sagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawr
    llknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvft
    aydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfp
    lkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleygge
    efsmedicqewtnfimksedylssis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oizB (B:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oizB (B:)
    gpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrardfdldlawrll
    knyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftay
    dvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplk
    vrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeef
    smedicqewtnfimksedylssise