PDB entry 1oip

View 1oip on RCSB PDB site
Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
Class: transport
Keywords: transport, ataxia, aved, transfer protein, tocopherol, vitamin e transport, disease mutation
Deposited on 2003-06-24, released 2004-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-tocopherol transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oipa1, d1oipa2
  • Heterogens: SO4, VIV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oipA (A:)
    maearsqpsagpqlnalpdhspllqpglaalrrrareagvplaplpltdsfllrflrard
    fdldlawrllknyykwraecpeisadlhprsiigllkagyhgvlrsrdptgskvliyria
    hwdpkvftaydvfrvslitselivqevetqrngikaifdlegwqfshafqitpsvakkia
    avltdsfplkvrgihlinepvifhavfsmikpfltekikerihmhgnnykqsllqhfpdi
    lpleyggeefsmedicqewtnfimksedylssisesiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oipA (A:)
    qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
    adlhprsiigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitseliv
    qevetqrngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifh
    avfsmikpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfim
    ksedylssise