PDB entry 1oio

View 1oio on RCSB PDB site
Description: gafd (f17c-type) fimbrial adhesin from escherichia coli
Class: lectin
Keywords: lectin, adhesin, n-acetyl-d-glucosamine binding, glcnac binding lectin
Deposited on 2003-06-22, released 2003-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial lectin
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oioa_
  • Chain 'B':
    Compound: fimbrial lectin
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oiob_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oioA (A:)
    avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oioB (B:)
    avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt