PDB entry 1oio

View 1oio on RCSB PDB site
Description: gafd (f17c-type) fimbrial adhesin from escherichia coli
Deposited on 2003-06-22, released 2003-08-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-15, with a file datestamp of 2003-08-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oioa_
  • Chain 'B':
    Domains in SCOP 1.67: d1oiob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oioA (A:)
    avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oioB (B:)
    avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt