PDB entry 1oim

View 1oim on RCSB PDB site
Description: family 1 b-glucosidase from thermotoga maritima
Class: hydrolase
Keywords: hydrolase, glucoside hydrolysis, family gh1, enzyme, deoxynojirimycin
Deposited on 2003-06-19, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OIM
    • Uniprot Q08638 (Start-467)
    Domains in SCOPe 2.06: d1oima_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OIM (Start-22)
    • Uniprot Q08638 (23-467)
    Domains in SCOPe 2.06: d1oimb1, d1oimb2
  • Heterogens: NOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oimA (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oimA (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekediravrfmh
    qfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfd
    pdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
    grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
    qkrivkdsgywysnvvknngled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oimB (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oimB (B:)
    snvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynr
    wkedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiy
    hwdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvh
    apgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeediravrf
    mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
    fdpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
    dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
    tqkrivkdsgywysnvvknngled