PDB entry 1oik

View 1oik on RCSB PDB site
Description: crystal structure of the alkylsulfatase atsk, a non-heme fe(II) alphaketoglutarate dependent dioxygenase in complex with fe, alphaketoglutarate and 2-ethyl-1-hexanesulfuric acid
Class: oxidoreductase
Keywords: oxidoreductase, jelly roll
Deposited on 2003-06-18, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WWU5
      • conflict (164)
    Domains in SCOPe 2.07: d1oika_
  • Chain 'D':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WWU5
      • conflict (164)
    Domains in SCOPe 2.07: d1oikd_
  • Heterogens: C26, AKG, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oikA (A:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsnrydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oikA (A:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvahranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpeplre
    ladklwavhsnryetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvt
    rlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oikD (D:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsnrydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oikD (D:)
    eldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfak
    llgepvahpvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwanta
    aayqelpeplreladklwavhsnrvyetehpvvrvhpisgeralqlghfvkrikgyslad
    sqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagev
    pvgvdgqlsrttrk