PDB entry 1oii

View 1oii on RCSB PDB site
Description: crystal structure of the alkylsulfatase atsk, a non-heme fe(II) alphaketoglutarate dependent dioxygenase in complex with iron and alphaketoglutarate
Class: oxidoreductase
Keywords: jelly roll, oxidoreductase
Deposited on 2003-06-18, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oiia_
  • Chain 'B':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oiib_
  • Chain 'C':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oiic_
  • Chain 'D':
    Compound: putative alkylsulfatase atsk
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oiid_
  • Heterogens: FE2, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oiiA (A:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiiA (A:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvpvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwantaa
    ayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslads
    qhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevp
    vgvdgqlsrttrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oiiB (B:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiiB (B:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvpvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwantaa
    ayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslads
    qhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevp
    vgvdgqlsrttrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oiiC (C:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiiC (C:)
    eldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfak
    llgepvranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpeplrelad
    klwavhsneyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrle
    ntvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oiiD (D:)
    msnaalataphaleldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgq
    thlddqsqegfakllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypka
    silrsvvapasggdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpakl
    erhrkvftstvyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtr
    lentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oiiD (D:)
    leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
    kllgepvtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqel
    peplreladklwavhsnyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavl
    qghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgql
    srttr