PDB entry 1oie

View 1oie on RCSB PDB site
Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Class: hydrolase
Keywords: metalloprotein, hydrolase, domain movement, disulfide engineering, conformational trapping, periplasmic
Deposited on 2003-06-16, released 2004-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.171
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein usha
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07024 (0-524)
      • engineered mutation (202)
      • engineered mutation (487)
    • PDB 1OIE (525-End)
    Domains in SCOPe 2.07: d1oiea1, d1oiea2, d1oiea3
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oieA (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkcgyvntgfidaevlkayiqksspldvsvyepkgevswqehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oieA (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvse
    rvlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnmgrlila
    aqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevidyltava
    qmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdgyprldn
    kcgyvntgfidaevlkayiqksspldvsvyepkgevswqe