PDB entry 1oid

View 1oid on RCSB PDB site
Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
Deposited on 2003-06-13, released 2004-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-05, with a file datestamp of 2004-08-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16861
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oidA (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkcgyvntgfidaevlkayiqksspldvsvyepkgevswqehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oidA (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkcgyvntgfidaevlkayiqksspldvsvyepkgevswqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oidB (B:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkcgyvntgfidaevlkayiqksspldvsvyepkgevswqehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oidB (B:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvlkvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkcgyvntgfidaevlkayiqksspldvsvyepkgevs