PDB entry 1oi8

View 1oi8 on RCSB PDB site
Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (p90c, l424c)
Class: hydrolase
Keywords: metalloprotein, hydrolase, domain movement, disulfide engineering, udp-sugar hydrolase
Deposited on 2003-06-10, released 2004-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein usha
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07024 (0-524)
      • engineered mutation (64)
      • engineered mutation (398)
    • PDB 1OI8 (525-End)
    Domains in SCOPe 2.07: d1oi8a1, d1oi8a2, d1oi8a3
  • Chain 'B':
    Compound: protein usha
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07024 (0-524)
      • engineered mutation (64)
      • engineered mutation (398)
    • PDB 1OI8 (525-End)
    Domains in SCOPe 2.07: d1oi8b1, d1oi8b2, d1oi8b3
  • Heterogens: MN, SO4, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi8A (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvcesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvckvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevswqehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi8A (A:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvcesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvckvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevswqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi8B (B:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvcesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvckvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevswqehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi8B (B:)
    yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
    ntgvcesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
    stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
    tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
    qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
    edgkservlytpeiaenqqmisllspfqnkgkaqlevkigetngrlegdrdkvrfvqtnm
    grlilaaqmdrtgadfavmsgggirdsieagdisyknvckvqpfgnvvvyadmtgkevid
    yltavaqmkpdsgaypqfanvsfvakdgklndlkikgepvdpaktyrmatlnfnatggdg
    yprldnkpgyvntgfidaevlkayiqksspldvsvyepkgevswqe