PDB entry 1oi6

View 1oi6 on RCSB PDB site
Description: structure determination of the tmp-complex of evad
Class: isomerase
Keywords: epimerase, vancomycin group antibiotic, evad, isomerase
Deposited on 2003-06-09, released 2004-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pcza361.16
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oi6a_
  • Chain 'B':
    Compound: pcza361.16
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1oi6b_
  • Heterogens: GOL, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi6A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi6A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi6B (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi6B (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpv