PDB entry 1oi6

View 1oi6 on RCSB PDB site
Description: structure determination of the tmp-complex of evad
Deposited on 2003-06-09, released 2004-06-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-03, with a file datestamp of 2004-06-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13043
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oi6a_
  • Chain 'B':
    Domains in SCOP 1.69: d1oi6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi6A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi6A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi6B (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi6B (B:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpv