PDB entry 1oi3

View 1oi3 on RCSB PDB site
Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli
Class: kinase
Keywords: kinase, dihydroxyacetone kinase, ycgt
Deposited on 2003-06-04, released 2003-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ycgt
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oi3a_
  • Chain 'B':
    Compound: hypothetical protein ycgt
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oi3b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi3A (A:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi3A (A:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oi3B (B:)
    mpyrncwskimkklindvqdvldeqlaglakahpsltlhqdpvyvtradapvagkvalls
    gggsghepmhcgyigqgmlsgacpgeiftsptpdkifecamqvdggegvlliiknytgdi
    lnfetatellhdsgvkvttvvidddvavkdslytagrrgvantvlieklvgaaaergdsl
    dacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpfss
    ldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatpl
    selygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtp
    alnwgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi3B (B:)
    dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
    sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
    vvidddvavkdslytagrrgvantvlieklvgaaaergdsldacaelgrklnnqghsigi
    algacladnemefgvgihgepgidrrpfssldqtvdemfdtllvngsyhrtlrfwdyqqg
    swqeeqqtkqplqsgdrvialvnnlgatplselygvynrlttrcqqagltiernligayc
    tsldmtgfsitllkvddetlalwdapvhtpalnwgk