PDB entry 1oi1

View 1oi1 on RCSB PDB site
Description: crystal structure of the mbt domains of human scml2
Class: mbt
Keywords: mbt, scml2, crystal structure
Deposited on 2003-06-04, released 2003-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: scml2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1OI1
      • engineered mutation (124)
    • Uniprot Q9UQR0 (Start-220)
    Domains in SCOPe 2.07: d1oi1a1, d1oi1a2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oi1A (A:)
    gstssvqrddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvci
    atvigitgarlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmntsswp
    mflletlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdev
    hitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oi1A (A:)
    fhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitgar
    lrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqswpmflletlngsemas
    atlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdevhitfdgwsgafdyw
    ckydsrdifpagwcrltgdvlqppgts